SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025468 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025468
Domain Number 1 Region: 496-831
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.32e-111
Family PDEase 0.000000307
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 6.28e-30
Family GAF domain 0.0004
Further Details:      
 
Domain Number 3 Region: 237-289,321-458
Classification Level Classification E-value
Superfamily GAF domain-like 2.55e-29
Family GAF domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025468   Gene: ENSMUSG00000024575   Transcript: ENSMUST00000025468
Sequence length 860
Comment pep:known chromosome:GRCm38:18:61220482:61289924:1 gene:ENSMUSG00000024575 transcript:ENSMUST00000025468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNIGFAKQYYNFHYRGKVISDLLGAKEAAVDFSNYHDVNSVEESEI
IFDLLRDVQENLQAEKCTFNVMKKLCFLLRADRMSLFMYRTRNGIAELATRLFNVHKDAV
LEDCLVMPDSEIVFPLDMGVVGHVAHSKKIANVPNTEEDEHFCDFVDNLTEYQTKNILAS
PIMNGKDVVAIIMAVNKIDEPHFTKRDEEILLKYLNFVNLIMKVFHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEAP
AYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPADHWALVSGLPTYVAQNGLICNIM
NAPAEDFFEFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDDMDETLM
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPW
ECEEEELAEILQGELPDAESYEINKFHFSDLPLTELELVKCGIQMYYELRVVDKFHIPQE
ALVRFMYSLSKGYRRITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYESTQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYEAKMKALEEEKQKQQAAKQAASGN
QPGGNPTPGGAPASKSCCIQ
Download sequence
Identical sequences Q8K0A8
NP_666198.1.92730 ENSMUSP00000025468 10090.ENSMUSP00000025468 ENSMUSP00000025468 ENSMUSP00000025468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]