SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026377 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026377
Domain Number 1 Region: 294-664
Classification Level Classification E-value
Superfamily Pentein 6.28e-167
Family Peptidylarginine deiminase Pad4, catalytic C-terminal domain 0.0000000000989
Further Details:      
 
Domain Number 2 Region: 115-293
Classification Level Classification E-value
Superfamily Peptidylarginine deiminase Pad4, middle domain 4.84e-66
Family Peptidylarginine deiminase Pad4, middle domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 4-114
Classification Level Classification E-value
Superfamily Cupredoxins 4.5e-37
Family Peptidylarginine deiminase Pad4, N-terminal domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026377   Gene: ENSMUSG00000025328   Transcript: ENSMUST00000026377
Sequence length 664
Comment pep:known chromosome:GRCm38:4:140785365:140810648:-1 gene:ENSMUSG00000025328 transcript:ENSMUST00000026377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQRIVRVSLEHPTSAVCVAGVETIVDIYGAVPEGTDMFEVYGTPGVDIYVSPSMERSR
ERADTRRWCFNKGLEIIVIMNSPSNDLNDSHVQIAYHSSREHLPLAYAVLYLTCVDITLD
CDMNCADRQDRSFVDKRQWVWGPDGYGAILLVNCDRDNVDSNAQDNCDQYVRCLQDLEDM
SVMVLRTQGPEALFEDHRLILHTSSCDAERARVFHVCGPEDSCESYKCVLGPDRMSYEVP
RLKGYEERFFVEGLSFPDAGFPGLISFHVTLLDDSNEDFSETPIFTDTAVFRVAPWIMTP
STLPPLEVYVCRVRNNTCFVEAVEELARKAGCKLTICPQAENRNDRWIQDEMELGYVQAP
HKTLPVVFDSPRNGELQGFPYKRILGLDFGYVTREPKDSSVSGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGSRGRRVTQVVRNFLHAQKVQPLVELFVDWLAVGHVDEFLSFVPA
PDGKGFRLLLASPGACFRLFQEKQKWGHGRSLLFEGVIGDRRVQTVSINQILNNQSLINF
NKFAQSCIDWNREVLKRELGLAEGDIIDIPQLFKTEKRKAVAFFPDLVNMLVLGKHLGIP
KPFGPIINGRCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVRREPFAFKWW
HMVP
Download sequence
Identical sequences Q9Z184
ENSMUSP00000026377 NP_035190.3.92730 ENSMUSP00000026377 10090.ENSMUSP00000026377 ENSMUSP00000026377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]