SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026381 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026381
Domain Number 1 Region: 294-666
Classification Level Classification E-value
Superfamily Pentein 4.32e-174
Family Peptidylarginine deiminase Pad4, catalytic C-terminal domain 0.0000000000142
Further Details:      
 
Domain Number 2 Region: 113-293
Classification Level Classification E-value
Superfamily Peptidylarginine deiminase Pad4, middle domain 1.2e-66
Family Peptidylarginine deiminase Pad4, middle domain 0.000000266
Further Details:      
 
Domain Number 3 Region: 6-112
Classification Level Classification E-value
Superfamily Cupredoxins 5.72e-33
Family Peptidylarginine deiminase Pad4, N-terminal domain 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026381   Gene: ENSMUSG00000025330   Transcript: ENSMUST00000026381
Sequence length 666
Comment pep:known chromosome:GRCm38:4:140745865:140774236:-1 gene:ENSMUSG00000025330 transcript:ENSMUST00000026381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGAVIHVAPEQPTHAVCVVGTATPLDVRGSAPKGYTTFGITASPGVIVDVIHGPPVKK
STMGASKWPLDPELEVTLQVKAASSRTDDEKVRVSYYGPKTSPVQALIYITGVELSLSAD
VTRTGRVKPAQAGKDQSTWTWGPGGRGAILLVNCDKEDPQASGMDFEDDKILDNKDLQDM
SPMTLSTKTPKDFFEKYQLVLEVPKAKMNRVRVFRATRGKLPSRYKVALGPQQFSYCLEL
PGGQHSTDFYVEGLAFPDADFKGLIPLTISLLDKSNPELPEALVFQDSVTFRVAPWIMTP
NTQPPQEVYVCRVSDNEDFLKSLATLTKKAKCKLTVCPEEENIDDQWMQDEMEIGYIQAP
HKTLPVVFDSPRDRGLKDFPVKRVMGPNFGYVTRKLYMSELTGLDAFGNLEVSPPVTVRG
KEYPLGRILIGNSGYSSSESRDMHQALQDFLSAQQVQAPVRLFSDWLFVGHVDEFLSFVP
ARDKQGFRLLLSSPRACYQLFQELQSQGHGEATLFEGLKRKRQTINEILSNKKLRDQNAY
VESCIDWNRAVLKRELGLAEGDIIDIPQLFKLAGNSRGNSKAQAFFPNMVNMLVLGKYLG
IPKPFGPIIDGHCCLEEEVRSHLEPLGLHCTFINDFYTYHVYNGEVHCGTNVRRKPFTFK
WWHMVP
Download sequence
Identical sequences Q9Z183
ENSMUSP00000026381 ENSMUSP00000026381 ENSMUSP00000026381 NP_035191.2.92730 10090.ENSMUSP00000026381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]