SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026411 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026411
Domain Number 1 Region: 282-471
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.36e-56
Family Hemopexin-like domain 0.00012
Further Details:      
 
Domain Number 2 Region: 82-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.03e-43
Family Matrix metalloproteases, catalytic domain 0.0000441
Further Details:      
 
Domain Number 3 Region: 23-90
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000722
Family MMP N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026411   Gene: ENSMUSG00000025355   Transcript: ENSMUST00000026411
Sequence length 527
Comment pep:known chromosome:GRCm38:10:128790953:128800824:1 gene:ENSMUSG00000025355 transcript:ENSMUST00000026411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWQQLWLAFLLPMTVSGRALGPTEKEAVLDYLLQYGYLQKPLEGADDFRLEDITEALRT
FQEASGLPISGQMDDATRARMKQPRCGLEDPFNQKSLKYLLLGHWRKKNLTFRIFNVPST
LSLPRVRAALHQAFKYWSSVAPLTFREVKAGWADIRLSFHGRQSLYCSNTFDGPGKVLAH
ADIPELGSIHFDKDELWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQP
FFKLHPDDVAGIQALYGKRSPETRDEEEETEMLTVSPVTAKPGPMPNPCSGEVDAMVLGP
RGKTYAFKGDYVWTVTDSGPGPLFQISALWEGLPGNLDAAVYSPRTRRTHFFKGNKVWRY
VDFKMSPGFPMKFNRVEPNLDAALYWPVNQKVFLFKGSGYWQWDELARTDLSRYPKPIKE
LFTGVPDRPSAAMSWQDGQVYFFKGKEYWRLNQQLRVAKGYPRNTTHWMHCGSQTPDTNS
STGDVTPSTTDTVLGTTPSTMGSTLDIPSATDSASLSFSANVTLLGA
Download sequence
Identical sequences Q2KHP2 Q9JHI0
ENSMUSP00000026411 NP_067387.1.92730 ENSMUSP00000026411 10090.ENSMUSP00000026411 ENSMUSP00000026411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]