SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026448 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000026448
Domain Number - Region: 43-137,310-372
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000366
Family Tricorn protease domain 2 0.035
Further Details:      
 
Domain Number - Region: 550-606
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.016
Family Transglutaminase, two C-terminal domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026448   Gene: ENSMUSG00000025384   Transcript: ENSMUST00000026448
Sequence length 879
Comment pep:novel chromosome:GRCm38:11:120369562:120378764:-1 gene:ENSMUSG00000025384 transcript:ENSMUST00000026448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASSRVHYLSDFCCPLGGRAAGKPFVLRHEAEVFLSTGREFVYVYDQEGGLLTAVYQF
PDQVWHLQLLAIRRALYVLCARTGIYCLSLDSLDRSGSQACEDKEEAAPPYPVIHVDPDA
CVLPDAALCAFTVLDDMLVTLAQGPTQWKMQLFERPCAGEEPLPRGQIGEVELSTCTPPG
GVPEKPAAPRFLPVLCCVFPPDSRAPHGHPQGCGCFTLEEALFGLLFGVDATLLQSPVIL
CGLPDGQLCCVVLKALVTSGLAPGDPKVLVKILHHLEEPVIFIGALRAEPHEEEAAGELL
PGQHEHSDCLVALGHQGRTLAIKASWSESGNLVPELREYCLPGPVLCAACDRDGHVYHST
PSDLCVVDLTRRDSPWNPEKPDGAIGGLPSVLCPASLNICSALALCVTARAPTGSTELLA
LSSKGRLITCSLDLNSEAPVPAKMAMANAGQKIKELLLDIGDVSERVSFLKKAVDQRNKA
ITSLNEAMNVSCALLSHPEGDRPIACTITTSWSRLELRDMLMATCTLENSSSFSLDQGWT
LCIQVLTSSSALDLDGTGSAFTYTIPVDRLGPGSRREVTLPLGPSESGVLDLPVTMSCWL
FYSLREVVGAALAPSDPLEAPYLEQFPLSLPKQEGVCLPLCKRTVDMLQCLRFAGAATHP
AQAPCMPGPACEPVETFLKTCQAPGSEPTGAASLRAKYLPPSTASIRVSAGLLRAALEDS
HSGFHLCSATLRWLLAENAAVDVVRAQTLSSIQGIAPDGTDVNLTVHEVAVTDLSPAGPI
QAVEIQVESSSLANMCRAHHAIIRRIQTMVTEQAALGSSPPDLRMQYLQQIHANHQELLR
EVQALRDQLCTEDELSSCSTAQKLLHIYKQLRNPSLVLL
Download sequence
Identical sequences A2ACJ2
NP_082256.2.92730 ENSMUSP00000026448 ENSMUSP00000026448 10090.ENSMUSP00000026448 ENSMUSP00000026448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]