SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026832 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026832
Domain Number 1 Region: 43-267
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.92e-38
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026832   Gene: ENSMUSG00000025736   Transcript: ENSMUST00000026832
Sequence length 271
Comment pep:known chromosome:GRCm38:17:25829043:25831842:1 gene:ENSMUSG00000025736 transcript:ENSMUST00000026832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFMAAAGRRGLLLLFVLWMMVTVILPASGEGGWKQNGLGIAAAVMEEERCTVERRAHITY
SEFMQHYAFLKPVILQGLTDNSKFRALCSRENLLASFGDNIVRLSTANTYSYQKVDLPFQ
EYVEQLLQPQDPASLGNDTLYFFGDNNFTEWASLFQHYSPPPFRLLGTTPAYSFGIAGAG
SGVPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTTLAWLLEIYPSLALSARPLECT
IQAGEVLYFPDRWWHATLNLDTSVFISTFLG
Download sequence
Identical sequences A0A0R4J059
ENSMUSP00000026832 NP_082377.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]