SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027157 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027157
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.67e-68
Family D-ribulose-5-phosphate 3-epimerase 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027157   Gene: ENSMUSG00000026005   Transcript: ENSMUST00000027157
Sequence length 228
Comment pep:known chromosome:GRCm38:1:66700831:66719805:1 gene:ENSMUSG00000026005 transcript:ENSMUST00000027157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDIEVDGGVGP
DTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences A0A0G2JW38 Q8VEE0
NP_079959.2.92730 XP_006245171.1.100692 400004 ENSMUSP00000027157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]