SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027487 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027487
Domain Number 1 Region: 266-515
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.49e-61
Family Leukotriene A4 hydrolase catalytic domain 0.00000412
Further Details:      
 
Domain Number 2 Region: 524-668
Classification Level Classification E-value
Superfamily ARM repeat 2.07e-36
Family Leukotriene A4 hydrolase C-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 28-103,138-260
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 6.54e-31
Family Leukotriene A4 hydrolase N-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027487   Gene: ENSMUSG00000026269   Transcript: ENSMUST00000027487
Sequence length 720
Comment pep:known chromosome:GRCm38:1:92910783:92920841:1 gene:ENSMUSG00000026269 transcript:ENSMUST00000027487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQCCCRKAPGAEAAPARPPPEPPPALDVASASSAQLFRLRHLQLGLELRPEARELAGC
LVLELCALRPAPRALVLDAHPALRLHSVSFRRASAVSESPCTFAFPAPGSGPPLPGFADA
PGAESASCPLAFRLDPFTDYGSSLTVTLPPEVQAHQPFQVILRYTSTDAPAIWWLDPELT
YGNAKPFVFTQGHSVCNRSFFPCFDTPAVKCTYSAVVKAPLGVQVLMSATQSVYVEEEGL
YHFHMEHPVPAYLVALVAGDLKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERL
YGPYMWGRYDIVFLPPSFPIVAMENPCLTFIISSILESDEFLVIDVIHEVAHSWFGNAVT
NATWEEMWLSEGLATYAQRRITTETYGAAFTCLETAFRLDALHRQMRLLGEDSPVSKLQV
KLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGGPQRFDDFLRAYVEKYKFTSVVAQDLLD
SFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQGSSLTRPVEALFQLWTAEPL
EQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVVMSLSKCYSSLLDSMNAEIRIRW
LQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFALEVFYQTQGRLHPNL
RRTIQQILSQGLGPSAEPSTEPSTDLGGAEADTNPDSPALLLGDEAPSSTISLRDVNVSA
Download sequence
Identical sequences G5E872
ENSMUSP00000027487 NP_852070.3.92730 ENSMUSP00000136080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]