SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027760 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027760
Domain Number 1 Region: 51-378,408-520
Classification Level Classification E-value
Superfamily Ras GEF 6.02e-120
Family Ras GEF 0.0000611
Further Details:      
 
Domain Number 2 Region: 639-734
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.98e-41
Family Ras-binding domain, RBD 0.00000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027760   Gene: ENSMUSG00000026482   Transcript: ENSMUST00000027760
Sequence length 768
Comment pep:known chromosome:GRCm38:1:152516951:152625217:-1 gene:ENSMUSG00000026482 transcript:ENSMUST00000027760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLWQAKMSSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQ
YETCKIRTIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNL
TGPNCEDDGSQSSPESKAVIRNAIASILRAWLDQCAEDFREPPHFPCLQKLLEYLKQMMP
GSDPERRAQNLLEQFQKQDVDSDNGLLNTSSFSLEEEEELESGGSAEFTNFSEDLVAEQL
TYMDAQLFKKVVPHHCLGCIWSQRDKKENKHLAPTIRATISQFNTLTKCVVSTVLGSKEL
KTQQRARVIEKWINIAHECRILKNFSSLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEE
LSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYL
GTFLTDLTMLDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSACNSYCMGPDQKFIQWF
QRQQLLSEEESYALSCEIEAAADANTTSPKPRKSMVKRLSLLFLGSDIIPGSTPTKEQPK
SAASGSSGESMDSVSVSSCESNHSEAEEGPVTPMDTPDEPQKKLSESSSSCSSIHSMDTN
SSGMSSLINPLSSPPTCNNNPKIHKRSVSVTSITSTVLPPVYNQQNEDTCIIRISVEDNN
GNMYKSIMLTSQDKTPAVIQRAMSKHNLESDPAEEYELVQVISEDKELVIPDSANVFYAM
NSQVNFDFILRKKNSVEEQVKLRSRTSLTLPRTAKRGCWSNRHSKITL
Download sequence
Identical sequences Q60695
NP_058542.2.92730 ENSMUSP00000027760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]