SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028233 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028233
Domain Number 1 Region: 997-1307
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.55e-74
Family Complement components 0.0000166
Further Details:      
 
Domain Number 2 Region: 1531-1679
Classification Level Classification E-value
Superfamily TIMP-like 6.67e-38
Family Netrin-like domain (NTR/C345C module) 0.000000813
Further Details:      
 
Domain Number 3 Region: 1379-1531
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 8.5e-28
Family Alpha-macroglobulin receptor domain 0.0024
Further Details:      
 
Domain Number 4 Region: 683-753
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 8.63e-21
Family Anaphylotoxins (complement system) 0.0000764
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000028233
Domain Number - Region: 569-629
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 0.0219
Family Creatinase/aminopeptidase 0.0094
Further Details:      
 
Domain Number - Region: 822-854
Classification Level Classification E-value
Superfamily E set domains 0.0434
Family SVA-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028233   Gene: ENSMUSG00000026874   Transcript: ENSMUST00000028233
Sequence length 1680
Comment pep:known chromosome:GRCm38:2:34983331:35061438:-1 gene:ENSMUSG00000026874 transcript:ENSMUST00000028233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLWGILCLLIFLDKTWGQEQTYVISAPKILRVGSSENVVIQVHGYTEAFDATLSLKSYP
DKKVTFSSGYVNLSPENKFQNAALLTLQPNQVPREESPVSHVYLEVVSKHFSKSKKIPIT
YNNGILFIHTDKPVYTPDQSVKIRVYSLGDDLKPAKRETVLTFIDPEGSEVDIVEENDYT
GIISFPDFKIPSNPKYGVWTIKANYKKDFTTTGTAYFEIKEYVLPRFSVSIELERTFIGY
KNFKNFEITVKARYFYNKVVPDAEVYAFFGLREDIKDEEKQMMHKATQAAKLVDGVAQIS
FDSETAVKELSYNSLEDLNNKYLYIAVTVTESSGGFSEEAEIPGVKYVLSPYTLNLVATP
LFVKPGIPFSIKAQVKDSLEQAVGGVPVTLMAQTVDVNQETSDLETKRSITHDTDGVAVF
VLNLPSNVTVLKFEIRTDDPELPEENQASKEYEAVAYSSLSQSYIYIAWTENYKPMLVGE
YLNIMVTPKSPYIDKITHYNYLILSKGKIVQYGTREKLFSSTYQNINIPVTQNMVPSARL
LVYYIVTGEQTAELVADAVWINIEEKCGNQLQVHLSPDEYVYSPGQTVSLDMVTEADSWV
ALSAVDRAVYKVQGNAKRAMQRVFQALDEKSDLGCGAGGGHDNADVFHLAGLTFLTNANA
DDSHYRDDSCKEILRSKRNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVA
RVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGRIHIKTLLPVMKADIRSYFPESWLWE
IHRVPKRKQLQVTLPDSLTTWEIQGIGISDNGICVADTLKAKVFKEVFLEMNIPYSVVRG
EQIQLKGTVYNYMTSGTKFCVKMSAVEGICTSGSSAASLHTSRPSRCVFQRIEGSSSHLV
TFTLLPLEIGLHSINFSLETSFGKDILVKTLRVVPEGVKRESYAGVILDPKGIRGIVNRR
KEFPYRIPLDLVPKTKVERILSVKGLLVGEFLSTVLSKEGINILTHLPKGSAEAELMSIA
PVFYVFHYLEAGNHWNIFYPDTLSKRQSLEKKIKQGVVSVMSYRNADYSYSMWKGASAST
WLTAFALRVLGQVAKYVKQDENSICNSLLWLVEKCQLENGSFKENSQYLPIKLQGTLPAE
AQEKTLYLTAFSVIGIRKAVDICPTMKIHTALDKADSFLLENTLPSKSTFTLAIVAYALS
LGDRTHPRFRLIVSALRKEAFVKGDPPIYRYWRDTLKRPDSSVPSSGTAGMVETTAYALL
ASLKLKDMNYANPIIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLLKQIHLDMDINVA
YKHEGDFHKYKVTEKHFLGRPVEVSLNDDLVVSTGYSSGLATVYVKTVVHKISVSEEFCS
FYLKIDTQDIEASSHFRLSDSGFKRIIACASYKPSKEESTSGSSHAVMDISLPTGIGANE
EDLRALVEGVDQLLTDYQIKDGHVILQLNSIPSRDFLCVRFRIFELFQVGFLNPATFTVY
EYHRPDKQCTMIYSISDTRLQKVCEGAACTCVEADCAQLQAEVDLAISADSRKEKACKPE
TAYAYKVRITSATEENVFVKYTATLLVTYKTGEAADENSEVTFIKKMSCTNANLVKGKQY
LIMGKEVLQIKHNFSFKYIYPLDSSTWIEYWPTDTTCPSCQAFVENLNNFAEDLFLNSCE
Download sequence
Identical sequences P06684
ENSMUSP00000028233 ENSMUSP00000028233 10090.ENSMUSP00000028233 ENSMUSP00000028233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]