SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028288 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028288
Domain Number 1 Region: 1862-2106
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-53
Family Ankyrin repeat 0.0000000566
Further Details:      
 
Domain Number 2 Region: 970-1101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000502
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 3 Region: 1170-1311
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000581
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 4 Region: 439-570
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000116
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 856-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000133
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 6 Region: 754-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000105
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 7 Region: 288-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 629-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 9 Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000871
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 791-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000196
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 11 Region: 1141-1184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000255
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 565-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000393
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 13 Region: 177-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000589
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 14 Region: 257-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000785
Family EGF-type module 0.02
Further Details:      
 
Domain Number 15 Region: 603-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.011
Further Details:      
 
Domain Number 16 Region: 219-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000599
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000987
Family EGF-type module 0.026
Further Details:      
 
Domain Number 18 Region: 1489-1522
Classification Level Classification E-value
Superfamily Notch domain 0.000000115
Family Notch domain 0.0052
Further Details:      
 
Domain Number 19 Region: 1529-1561
Classification Level Classification E-value
Superfamily Notch domain 0.000000183
Family Notch domain 0.0043
Further Details:      
 
Domain Number 20 Region: 59-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000229
Family EGF-type module 0.013
Further Details:      
 
Domain Number 21 Region: 1308-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000268
Family EGF-type module 0.015
Further Details:      
 
Domain Number 22 Region: 1390-1428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000547
Family EGF-type module 0.021
Further Details:      
 
Domain Number 23 Region: 1448-1480
Classification Level Classification E-value
Superfamily Notch domain 0.00000301
Family Notch domain 0.00021
Further Details:      
 
Domain Number 24 Region: 1112-1149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000607
Family EGF-type module 0.022
Further Details:      
 
Domain Number 25 Region: 1345-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000133
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000028288
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000512
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 832-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028288   Gene: ENSMUSG00000026923   Transcript: ENSMUST00000028288
Sequence length 2531
Comment pep:known chromosome:GRCm38:2:26457903:26503822:-1 gene:ENSMUSG00000026923 transcript:ENSMUST00000028288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRLLTPLLCLTLLPALAARGLRCSQPSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDS
NPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVN
ECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTT
HECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGA
NPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHC
ETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKID
GYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNEC
NSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKN
SGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYT
GRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANC
TDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQY
DVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQ
YHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGS
YCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCID
LTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFV
GERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCRGKPCKNGG
VCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTG
PECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHILDYSFTGGAGRDI
PPPQIEEACELPECQVDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYY
GHEEELRKHPIKRSTVGWATSSLLPGTSGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSS
QCFQSATDVAAFLGALASLGSLNIPYKIEAVKSEPVEPPLPSQLHLMYVAAAAFVLLFFV
GCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQ
NEWGDEDLETKKFRFEEPVVLPDLSDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDAD
CMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGET
ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLRNRATDLDA
RMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKN
GANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
RLLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACGS
KEAKDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMP
LSHLPGMPDTHLGISHLNVAAKPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNG
TGAMNFTVGAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPGTLSTQAAGLQHSMMGPL
HSSLSTNTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQLQPQNLQPPSQPHLSVSSAA
NGHLGRSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMVPPMTTTQFLTPP
SQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTTMP
SQITHIPEAFK
Download sequence
Identical sequences Q01705
10090.ENSMUSP00000028288 ENSMUSP00000028288 ENSMUSP00000028288 NP_032740.3.92730 ENSMUSP00000028288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]