SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028312 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028312
Domain Number 1 Region: 27-190
Classification Level Classification E-value
Superfamily Lipocalins 4.69e-33
Family Retinol binding protein-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028312   Gene: ENSMUSG00000026943   Transcript: ENSMUST00000028312
Sequence length 193
Comment pep:known chromosome:GRCm38:2:25490845:25493911:-1 gene:ENSMUSG00000026943 transcript:ENSMUST00000028312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPWWALWLILTLPQILESQISAMSQGFPQMTSFQSDQFQGEWFVLGLADNTFRREHRAL
LNFFTTLFELKEKSQFQVTNSMTRGKHCNTWSYTLIPATKPGQFTRDNRGSGPGADRENI
QVIETDYITFALVLSLRQTSSQNITRVSLLGRNWRLSHKTIDKFICLTRTQNLTKDNFLF
PDLSDWLPDPQVC
Download sequence
Identical sequences Q2TA58 Q6JVL5
10090.ENSMUSP00000028312 ENSMUSP00000028312 ENSMUSP00000028312 ENSMUSP00000028312 NP_084234.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]