SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028721 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028721
Domain Number 1 Region: 152-468
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.18e-125
Family Transglutaminase core 0.0000000104
Further Details:      
 
Domain Number 2 Region: 7-150
Classification Level Classification E-value
Superfamily E set domains 9.45e-43
Family Transglutaminase N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 624-721
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.52e-28
Family Transglutaminase, two C-terminal domains 0.00028
Further Details:      
 
Domain Number 4 Region: 510-621
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.07e-26
Family Transglutaminase, two C-terminal domains 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028721   Gene: ENSMUSG00000053675   Transcript: ENSMUST00000028721
Sequence length 724
Comment pep:known chromosome:GRCm38:2:121046111:121085841:-1 gene:ENSMUSG00000053675 transcript:ENSMUST00000028721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGCPITGLEVALTDLQSSQNNVRHHTEEISVDRLVVRRGQAFSITLYFKNRGFQPGMD
SIMFVAETGPLPDLAKGTRAVFSFTGSGGPSPWIASLEANRANSLEVSLCAPPIAAVGRY
LLKIRIDSYQGFVTAYQLGEFILLFNPWCPADSVYLESEPQRQEYVVNDYGFIYQGSKSW
IRPCPWNYGQFEENIIDICLELLEKSLNFQVDPSTDCALRGSPVYTSRVVCAMINSNDDN
GVLNGNWSENYVDGINPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIP
TRVITNFDSGHDTDGNLIIDEYYDNTGRILENMKKDTVWNFHVWNECWMARKDLPPGYGG
WQVLDATPQETSNGLYCCGPASVKAIKEGEIDLNYDTRFAFSMVNADCMSWLVYGGKEQK
LHQDTATVGNFISTKSIQSDERDDITESYKYEEGSLQEREVFLKALQKLQATRSQGPHQA
NSNPFSSVPPRHNSARSPDSPSLQPSDVLQVSLKFELLDSPKMGQDINFVLLAVNMSPQF
KDLKLNLSAQSLLHDGSPLVPFWQDTAFITLFPEEEKSYPCKILYSQYSQYLSTDKLIRI
SALGEEKNSPEKILVNKIITLTFPGIMINVLGAAFVNQPLTVQVVFSNPLSEPVEDCVLT
LEGSGLFRKQQRVLIGVLKPHHKASITLKTVPFKSGQRQIQANLRSNRFKDIKGYKNVYV
DIGL
Download sequence
Identical sequences Q9D7I9
NP_083075.1.92730 ENSMUSP00000028721 ENSMUSP00000028721 ENSMUSP00000028721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]