SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028817 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028817
Domain Number 1 Region: 127-255
Classification Level Classification E-value
Superfamily DNA clamp 2.28e-47
Family DNA polymerase processivity factor 0.000000411
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily DNA clamp 3.43e-42
Family DNA polymerase processivity factor 0.00000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028817   Gene: ENSMUSG00000027342   Transcript: ENSMUST00000028817
Sequence length 261
Comment pep:known chromosome:GRCm38:2:132249162:132253314:-1 gene:ENSMUSG00000027342 transcript:ENSMUST00000028817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVIKMPSGEFARICRDLSHIGDAVVISCAKNGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEAS
Download sequence
Identical sequences P17918 Q542J9
NP_035175.1.92730 ENSMUSP00000028817 10090.ENSMUSP00000028817 ENSMUSP00000028817 ENSMUSP00000028817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]