SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028888 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028888
Domain Number 1 Region: 143-461
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.69e-127
Family Transglutaminase core 0.0000000044
Further Details:      
 
Domain Number 2 Region: 3-142
Classification Level Classification E-value
Superfamily E set domains 4.55e-42
Family Transglutaminase N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 494-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.1e-29
Family Transglutaminase, two C-terminal domains 0.00025
Further Details:      
 
Domain Number 4 Region: 608-703
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.07e-25
Family Transglutaminase, two C-terminal domains 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028888   Gene: ENSMUSG00000027403   Transcript: ENSMUST00000028888
Sequence length 706
Comment pep:known chromosome:GRCm38:2:130123275:130154232:1 gene:ENSMUSG00000027403 transcript:ENSMUST00000028888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVRITKVDWQHSKNGAAHHTQDYPCSELVVRRGQLFSLTLDLSRVLDSEEALIFTVET
GPHASEALHTKAVFQTAELEIGDTWTAAKEEQTENTITVSLSSPSNAVIGRYLLSVRPSS
RRKHSDRKLGQFILLFNPWCPEDDVFLDSEEERQEYVLNDSGVIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDRSPSHQEDPATDVSHRHDPVYVTRIISAMVNSNNDRGVVQGQWQG
KYGGGTNPLNWRGSVAILQKWFKGRYKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNS
AHDTDGNLSVDKYVDSYGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYDGWQVLDATPQ
EESEGMFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDKRRERVYSDTKKI
GRCISTKAVGSDSRVDITGLYKYPEGSRKERQVYSKAVKKLLSVEAWGRRRRIRRASVRG
VWRDDLLEPVTKPSITGKFKVLEPPVLGQDLKLALCLTNLTARAQRVRVNVSGATILYTR
KPVAEILRESHTVKLGPLEEKKIPVTISYSQYKGDLTEDKKILLAAMCLVSKGEKLLVEK
DITLEDFITIKVLGPAVVGVTVTVEVLVINPLSESVKDCVLMVEGSGLLQGQLSIEVPSL
QPQEKALIQFNITPSKSGPRQLQVDLVSSQFPDIKGFVIIHVATAK
Download sequence
Identical sequences Q8BM11
ENSMUSP00000028888 ENSMUSP00000028888 ENSMUSP00000028888 NP_808394.1.92730 10090.ENSMUSP00000028888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]