SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029076 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029076
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.23e-98
Family Carbonic anhydrase 0.0000000000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029076   Gene: ENSMUSG00000027559   Transcript: ENSMUST00000029076
Sequence length 260
Comment pep:known chromosome:GRCm38:3:14863538:14872351:1 gene:ENSMUSG00000027559 transcript:ENSMUST00000029076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEWGYASHNGPDHWHELYPIAKGDNQSPIELHTKDIKHDPSLQPWSASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILLDALDKIKTKGKEAPFTHFDP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFSSAENEPPVPL
VGNWRPPQPVKGRVVRASFK
Download sequence
Identical sequences P16015
ENSMUSP00000029076 NP_031632.2.92730 ENSMUSP00000029076 ENSMUSP00000029076 10090.ENSMUSP00000029076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]