SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029566 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029566
Domain Number 1 Region: 17-148
Classification Level Classification E-value
Superfamily Cupredoxins 1.46e-48
Family Ephrin ectodomain 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029566   Gene: ENSMUSG00000027954   Transcript: ENSMUST00000029566
Sequence length 205
Comment pep:known chromosome:GRCm38:3:89271733:89279645:-1 gene:ENSMUSG00000027954 transcript:ENSMUST00000029566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVA
DAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEF
KEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIG
YSAAPRLFPLVWAVLLLPLLLLQSQ
Download sequence
Identical sequences P52793
NP_034237.3.92730 ENSMUSP00000029566 10090.ENSMUSP00000029566 ENSMUSP00000029566 ENSMUSP00000029566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]