SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029673 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029673
Domain Number 1 Region: 31-162
Classification Level Classification E-value
Superfamily Cupredoxins 2.19e-47
Family Ephrin ectodomain 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029673   Gene: ENSMUSG00000028039   Transcript: ENSMUST00000029673
Sequence length 230
Comment pep:known chromosome:GRCm38:3:89313899:89322965:-1 gene:ENSMUSG00000028039 transcript:ENSMUST00000029673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQR
YSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGP
NVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTLLAS
Download sequence
Identical sequences O08545
NP_034238.1.92730 XP_001072657.1.4139 XP_021052019.1.100879 XP_574979.4.100692 ENSMUSP00000029673 ENSMUSP00000029673 10090.ENSMUSP00000029673 ENSRNOP00000059725 ENSMUSP00000029673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]