SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029915 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029915
Domain Number 1 Region: 28-148
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.23e-24
Family Single-domain sulfurtransferase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029915   Gene: ENSMUSG00000028251   Transcript: ENSMUST00000029915
Sequence length 157
Comment pep:novel chromosome:GRCm38:4:21757382:21767212:-1 gene:ENSMUSG00000028251 transcript:ENSMUST00000029915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARLVLGTSGRAALGSVEPALGGLKSIWRCSQAFCSTPKGVTYRELKSLLNSKDIMLID
VRNTLEILEQGKIPGSINIPLDEVGEALQMNPVDFKEKYCQVKPSKSDRLVFSCLAGVRS
KKAMDTAISLGFNSAQHYAGGWKEWVTYEISEEKQES
Download sequence
Identical sequences Q9D0B5
NP_084116.1.92730 ENSMUSP00000029915 ENSMUSP00000029915 ENSMUSP00000029915 mmk001006199.1 mmk001006199.2 10090.ENSMUSP00000029915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]