SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030158 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000030158
Domain Number - Region: 5-70
Classification Level Classification E-value
Superfamily BAG domain 0.0243
Family BAG domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030158   Gene: ENSMUSG00000028447   Transcript: ENSMUST00000030158
Sequence length 186
Comment pep:known chromosome:GRCm38:4:41714798:41723170:-1 gene:ENSMUSG00000028447 transcript:ENSMUST00000030158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTDVQRLQSRVEELERWVYGPGGTRGSRKVADGLVKVQVALGNIASKRERVKILYKK
IEDLIKYLDPEYIDRIAIPEASKLQFILAEEQFILSQVALLEQVNALVPVLDSASIKAVP
EHAARLQRLAQIHIQQQDQCVAITEESKALLEGYNKTTMLLSKQFVQWDELLCQLEAAKQ
VKPAEE
Download sequence
Identical sequences Q9Z0Y1
ENSMUSP00000030158 ENSMUSP00000030158 NP_058586.3.92730 ENSMUSP00000030158 GO.35636 10090.ENSMUSP00000030158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]