SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Mus musculus 76_38 > ENSMUSP00000030356

Domain assignment for ENSMUSP00000030356 from Mus musculus 76_38

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSMUSP00000030356
Domain Number 1 Region: 416-676
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-54
Family YWTD domain 0.0000000202
Further Details:      
 
Domain Number 2 Region: 39-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 3 Region: 250-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 4 Region: 159-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 285-325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 6 Region: 199-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 78-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000956
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 8 Region: 115-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 9 Region: 327-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 10 Region: 360-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000712
Family EGF-type module 0.0014
Further Details:      
 
Domain Number 11 Region: 686-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000206
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030356   Gene: ENSMUSG00000028613   Transcript: ENSMUST00000030356
Sequence length 955
Comment pep:novel chromosome:GRCm38:4:107802314:107873899:1 gene:ENSMUSG00000028613 transcript:ENSMUST00000030356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MGRPELGALRPLALLLLLLLQLQHLSAADPLPGGQGPVKECEEDQFRCRNERCIPLVWRC
DEDNDCSDNSDEDDCPKRTCADSDFTCDNGHCIPERWKCDGEEECPDGSDESKATCSSEE
CPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCPTLCAPHEFQCSNRSCLASVFVC
DGDDDCGDGSDERGCSDPACPPREFRCGGGGTCIPERWVCDRQFDCEDRSDEAAELCGRA
GQGTTATPAACAPTAQFTCRSGECIHLGWRCDGDRDCKDKSDEADCSPGPCRENEFQCGD
GTCVLAIKRCNQERDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGFQL
LDQKTCGDIDECQDPDACSQICVNYKGYFKCECHPGYEMDTLTKNCKAVAGKSPSLIFTN
RHEVRRIDLVKRDYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAHMDKASIPDEQ
VVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVD
PLRGFMYWSDWGFQAKIEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQL
SSIDFNGGNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAEN
LNNPHDIVIFHELKQPKAADACDLSAQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLG
PDMKRCYRAPQSTSTTTLASAMTRTVPATTRAPGTTIHDPTYQNHSTETPSQTAAAPHSV
NVPRAPSTSPSTPSPATSNHSQHYGNEGSQMGSTVTAAVIGVIVPIVVIALLCMSGYLIW
RNWKRKNTKSMNFDNPVYRKTTEEEEEDELHIGRTAQIGHVYPAAISNYDRPLWAEPCLG
ETRDLEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKCKRVALSLEDDGLP
Download sequence
Identical sequences B1AXJ4
ENSMUSP00000030356 XP_011238762.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.