SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030937 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030937
Domain Number 1 Region: 75-254
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.34e-42
Family Matrix metalloproteases, catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 309-389
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000125
Family I set domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030937   Gene: ENSMUSG00000029061   Transcript: ENSMUST00000030937
Sequence length 391
Comment pep:known chromosome:GRCm38:4:155650655:155653384:-1 gene:ENSMUSG00000029061 transcript:ENSMUST00000030937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCRACLRPEASGAVQGRWLGAALSGLCLLSALALLEWLGAPTETAWRAAQGNVDAPNVG
SSTAQVPRLLTMSVTRRRRYTLTPARLRWDHFNLTYRVLSFPRNLLSPEETRRGLAAAFR
MWSDVSPFSFREVAPERPSDLKIGFYPVNHTDCLVSAVHHCFDGPTGELAHAFFPPHGGI
HFDDSEYWVLGPTRYSWKKGVWLTNLVHVAAHEIGHALGLMHSQQDQALMHLNATLRGWK
ALSQDELWGLHRLYGCLDRIFVCASWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVAT
TTSPTRTKTRLVREGRNMTFHCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAQLSII
ANAVNEGTYTCVVRRHQRVLSTYSWRVRVRN
Download sequence
Identical sequences O88676
10090.ENSMUSP00000030937 ENSMUSP00000030937 ENSMUSP00000030937 ENSMUSP00000030937 NYSGRC-IgSF-O88676 NP_036115.1.92730 XP_006538945.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]