SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031276 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031276
Domain Number 1 Region: 1-469
Classification Level Classification E-value
Superfamily Ras GEF 1.16e-120
Family Ras GEF 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031276   Gene: ENSMUSG00000029333   Transcript: ENSMUST00000031276
Sequence length 473
Comment pep:known chromosome:GRCm38:5:99217426:99252927:-1 gene:ENSMUSG00000029333 transcript:ENSMUST00000031276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDR
TYIFTFLLSSRLFMHPYELMAKVCHLCVEHQRLSEGDGDKNQMRKIAPKILQLLTEWTET
FPYDFRDERMMRNLKDLAHRMASGEEQTYRKNVQQMMQCLIRKLAALSQYEEVLAKLSST
ATDRLTVLKTKPQSIQRDIMTVCSDPYTLAQQLTHIELERLNYIGPEEFVQAFVQKDPLD
NDKSCYSERKKTRNLEAYVEWFNRLSYLVATEICMPVKKKHRARMIEYFIDVARECFNIG
NFNSLMAIISGMNMSPVSRLKKTWAKVKTAKFDILEHQMDPSSNFYNYRTALRGAAQRSL
TAHSSREKIVIPFFSLLIKDIYFLNEGCVNRLPNGHVNFEKFWELAKQVSEFMTWKQVEC
PFERDRKVLQYLLSVPVFSEDALYLASYESEGPENNIEKDRWKSLRSSLLGRV
Download sequence
Identical sequences Q8JZL7
ENSMUSP00000031276 ENSMUSP00000031276 NP_665838.1.92730 XP_021066081.1.100879 10090.ENSMUSP00000031276 ENSMUSP00000031276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]