SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031456 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031456
Domain Number 1 Region: 494-837
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.2e-115
Family PDEase 0.000000274
Further Details:      
 
Domain Number 2 Region: 52-248
Classification Level Classification E-value
Superfamily GAF domain-like 3.71e-38
Family GAF domain 0.00027
Further Details:      
 
Domain Number 3 Region: 235-279,306-455
Classification Level Classification E-value
Superfamily GAF domain-like 7.46e-32
Family GAF domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031456   Gene: ENSMUSG00000029491   Transcript: ENSMUST00000031456
Sequence length 856
Comment pep:known chromosome:GRCm38:5:108388391:108431743:1 gene:ENSMUSG00000029491 transcript:ENSMUST00000031456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQVRSFLDGNPTFAHQYFGKKLSPENVAGACEDGWLADCGSLRELCQVEESAALF
ELVQDMQESVNMERVVFKILRRLCTILHADRCSLFMYRQRNGIAELATRLFSVQPDSLLE
DCLVPPDSEIVFPLDIGIVGHVAQTKKMINVQDVAECPHFSSFADELTDYVTKNILSTPI
MNGKDVVAVIMAVNKLDGPCFTSEDEDVFTKYLNFATLNLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWPVLMGEAQPY
SGPRTPDGREIVFYKVIDYILHGKEDIKVIPTPPADHWALASGLPTYVAESGFICNIMNA
SADEMFNFQEGPLDDSGWVIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDDQDEVLMES
LTQFLGWSVLNTDTYDKMNKLENRKDIAQDMVLYHVRCDKDEIQEILPTRDRLGKEPADC
EEDELGKILKEELPGPTKFDIYEFHFSDLECTELELVKCGIQMYYELGVVRKFQIPQEVL
VRFLFSVSKAYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLAEESLNIYQNLNRRQHEHVIHLM
DIAIIATDLALYFKKRTMFQKIVDESKNYEDKKSWVEYLSLETTRKEIVMAMMMTACDLS
AITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCT
FVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEEKKKEEDRVAAKKVGTE
VCNGGPAPKSSTCCIL
Download sequence
Identical sequences P23440
ENSMUSP00000031456 ENSMUSP00000031456 ENSMUSP00000031456 NP_032832.2.92730 10090.ENSMUSP00000031456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]