SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031650 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031650
Domain Number 1 Region: 174-245
Classification Level Classification E-value
Superfamily Homeodomain-like 1.54e-23
Family Homeodomain 0.00056
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000031650
Domain Number - Region: 243-284
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.017
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031650   Gene: ENSMUSG00000029646   Transcript: ENSMUST00000031650
Sequence length 311
Comment pep:known chromosome:GRCm38:5:147300805:147307270:-1 gene:ENSMUSG00000029646 transcript:ENSMUST00000031650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAATANLDSAQS
PGPSWPTAYGAPLREDWNGYAPGGAAAANAVAHGLNGGSPAAAMGYSSPAEYHAHHHPHH
HPHHPAASPSCASGLLQTLNLGPPGPAATAAAEQLSPSGQRRNLCEWMRKPAQQSLGSQV
KTRTKDKYRVVYTDHQRLELEKEFHFSRYITIRRKSELAATLGLSERQVKIWFQNRRAKE
RKIKKKQQQQQQQQQQQPPQPPPQPSQPQPGALRSVPEPLSPVTSLQGSVPGSVPGVLGP
AGGVLNSTVTQ
Download sequence
Identical sequences P43241 Q543L9
10090.ENSMUSP00000031650 NP_031699.2.92730 ENSMUSP00000031650 ENSMUSP00000031650 ENSMUSP00000031650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]