SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032203 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032203
Domain Number 1 Region: 958-1267
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.06e-92
Family Complement components 0.0000277
Further Details:      
 
Domain Number 2 Region: 1339-1470
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.7e-38
Family Alpha-macroglobulin receptor domain 0.000000774
Further Details:      
 
Domain Number 3 Region: 786-906
Classification Level Classification E-value
Superfamily E set domains 2.38e-34
Family SVA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032203   Gene: ENSMUSG00000030111   Transcript: ENSMUST00000032203
Sequence length 1474
Comment pep:known chromosome:GRCm38:6:121636173:121679237:1 gene:ENSMUSG00000030111 transcript:ENSMUST00000032203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRWLPSLALLPLPPPLLLLLLLLLPTNASAPQKPIYMVMVPSLLHAGTPEKGCLLFNH
LNETVTVKVSMESVRGNQSLFTDLVVDKDLFHCASFIVPQSSSNEVMFLTVQVKGPTHEF
RRRSTVLIKTKESLVFAQTDKPIYKPGQMVRFRVVSLDENFHPLNELIPLLYIQDSKKNR
IAQWQNFRLEGGLKQLSFPLSSEPTQGSYKVVIRTESGRTVEHPFSVKEFVLPKFEVKVA
VPETITILEEEMNVSVCGIYTYGKPVPGHVTVNICRKYSNPSSCFGEESLAFCEKFSQQL
DGRGCFSQLVKTKSFQLKRQEYEMQLDVNAKIQEEGTGVEETGKGLTKITRTITKLSFVN
VDTHFRQGIPFVGQVLLVDGRGTPIPYEMIFIGADEANQNINTTTDKNGLARFSINTDDI
MGTSLTVRAKYKDSNVCYGFRWLTEENVEAWHTANAVFSPSRSFVHLESLPYKLRCEQTL
AVQAHYILNDEAVLERKELVFYYLMMAKGGIVRAGTHVLPVTQGHKKGHFSILISMETDL
APVARLVLYTILPNGEVVGDTVKYEIEKCLANKVDLVFHPNIGLPATRAFLSVMASPQSL
CGLRAVDQSVLLTKPEAELSASLVYDLLPVKDLTGFPKGVNQQEEDTNGCLKQNDTYING
ILYSPVQNTNEEDMYGFLKDMGLKVFTNLNIRKPKVCERLGVNKIPAAYHLVSQGHMDAF
LESSESPTETTRSYFPETWIWDLVIVDSTGVAEMEVTVPDTITEWKAGAFCLSNDTGLGL
SPVIDFQAFQPFFVDLTMPYSVIRGEAFTLKATVLNYLQTCIRVGVQLEASPDFLATPEE
KEQKSHCICMNERHTMSWAVIPKSLGNVNFTVSAEALDSKELCRNEVPVVPERGKKDTII
KSLLVEPEGLENEVTFNSLLCPTGAEVSEQISLKLPSDVVEESARASVTVLGDILGSAMQ
NTQDLLKMPYGCGEQNMVLFAPNIYVLDYLNETEQLTQEIKTKAITYLNTGYQRQLNYKH
RDGSYSTFGDKPGRSHANTWLTAFVLKSFAQARRYIFIDESHITQALTWLSQQQKDNGCF
RSSGSLLNNAMKGGVEDEVTLSAYITIALLEMSLPVTHPVVRNALFCLDTAWKSARRGAS
GNHVYTKALLAYAFALAGNQDTKKEILKSLDEEAVKEDNSVHWTRAQKPRVPADLWYQPQ
APSAEVEMTAYVLLAYLTTELVPTREDLTAAMLIVKWLTKQQNSHGGFSSTQDTVVALHA
LSKYGAATFTRAKKAAHVTIQSSGAFYTKFQVNNDNQLLLQRVTLPTVPGDYTAKVAGEG
CVYLQTSLKYSVLPREKEFPFALVVQTLPGTCEDLKAHTTFQISLNISYIGSRSDSNMAI
ADVKMVSGFIPLKPTVKMLERSVHVSRTEVSNNHVLIYLDKVSNQMLTLFFMVQQDIPVR
DLKPAIVKVYDYYEKDEFAVAKYSAPCSAGYGNA
Download sequence
Identical sequences Q6GQT1
NP_783327.2.92730 ENSMUSP00000032203 ENSMUSP00000032203 10090.ENSMUSP00000032203 ENSMUSP00000032203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]