SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032728 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032728
Domain Number 1 Region: 389-671
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.38e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 212-386
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.88e-55
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00012
Further Details:      
 
Domain Number 3 Region: 673-781
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.18e-27
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 155-209
Classification Level Classification E-value
Superfamily TGS-like 0.000000000024
Family TGS domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032728   Gene: ENSMUSG00000030515   Transcript: ENSMUST00000032728
Sequence length 790
Comment pep:known chromosome:GRCm38:7:65644898:65692091:1 gene:ENSMUSG00000030515 transcript:ENSMUST00000032728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQALAAQAVASRLQRQEEDIRWLCAEVQRLRDEQLRGPERGQAEGPRLTREVAQLQAE
NRDLHQRLCGLRLRLAEQRRTEAGRAAAHEPPTQNQEKDTKKKRLKQSEPGREVKQPNFI
KERLQLFETLKTDHQLLPATQEKKNTNNVISVRVAGGKTVQGERWKTTPYQVAAGISKEL
AEHTVIAKVNGVLWDLDRPLEGDSTVELLMFDNEEAQAVYWHSSAHILGEAMELYYGGHL
CYGPPIENGFYYDMFIEDRVVSSTELSALENICKTIIKEKQPFERLEVSKDTLLEMFKYN
KFKCRILKEKVDTPTTTVYRCGPLIDLCKGPHVRHTGKIKAIKIFKNSSTYWEGNPEMET
LQRIYGISFPDSKMMKDWEKFQEEAKSRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIY
NALMDFIREEYHKRNFTEVLSPNMYNSKLWETSGHWQHYSNNMFTFDVEKDTFALKPMNC
PGHCLMFAHRPRSWREMPVRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCMVEQIE
EEIKGCLHFLQSVYSTFGFSFQLNLSTRPEHFLGEIEIWDEAERQLQNSLVEFGKPWKIN
PGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSKDGDDKNRPVIIHRAI
LGSVERMIAILSENYGGKWPLWLSPRQVMVIPVGPACENYALQVSKECFEEGFMADVDLD
DSCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTRDNKIHGEISIASVIEKLKNLKK
SRTLNAEEDF
Download sequence
Identical sequences Q8BLY2
10090.ENSMUSP00000032728 ENSMUSP00000032728 ENSMUSP00000032728 ENSMUSP00000032728 NP_758514.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]