SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032770 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032770
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 2.22e-31
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032770   Gene: ENSMUSG00000030553   Transcript: ENSMUST00000032770
Sequence length 130
Comment pep:known chromosome:GRCm38:7:68236608:68264233:-1 gene:ENSMUSG00000030553 transcript:ENSMUST00000032770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSAKAIFLEQCGKNRGYRDSDVRGFQPEDGVCLPGGPEVRLSVVNMKEVCRRVAVENV
EVAFSRDAGRYICDYTYYLSLHLGTGHAALIHVPPLSHWLSASLLGKALRVIIQEMLEEI
GKVQTQSTAA
Download sequence
Identical sequences E9QM76
10090.ENSMUSP00000032770 ENSMUSP00000032770 ENSMUSP00000032770 ENSMUSP00000032770 NP_084377.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]