SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033015 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033015
Domain Number 1 Region: 57-364,467-505
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.89e-65
Family FAD-linked reductases, N-terminal domain 0.0000405
Further Details:      
 
Domain Number 2 Region: 345-451
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.64e-24
Family L-aminoacid/polyamine oxidase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033015   Gene: ENSMUSG00000074141   Transcript: ENSMUST00000033015
Sequence length 630
Comment pep:known chromosome:GRCm38:7:44836287:44840809:1 gene:ENSMUSG00000074141 transcript:ENSMUST00000033015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLALRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLLKVVTLGLNRTSKPQK
VVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEKTGWIGELGAMRMPSSH
RILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPEKLGYNLNNRERGHSPED
IYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSRPAVQLLGDVMSEEGFFYL
SFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALLLNAPVVSITQGRNDVRVHI
ATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEALRALHYVAASKVFLSFRRPF
WHEEHIEGGHSNTDRPSRLIFYPAQGEGSLLLASYTWSDAAAPFAGLSTDQTLRLVLQDV
AALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLYGREAEDYDWSAPFGRIYFAGEH
TALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMMEHAYAEANYLDQYPEGERPEEQQA
REEVSPDEQEPSHKHLLVETSPEGQQHAFVEAIPELQGHVFVETVPQEKGHAHQNIYPSE
HVQVHGEVIPEWHGHGGSGTPQMHRVGDHS
Download sequence
Identical sequences A0A0R4J0C2
NP_034345.2.92730 ENSMUSP00000033015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]