SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033278 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033278
Domain Number 1 Region: 329-536
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-41
Family Hemopexin-like domain 0.00049
Further Details:      
 
Domain Number 2 Region: 171-326
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.58e-35
Family Matrix metalloproteases, catalytic domain 0.0002
Further Details:      
 
Domain Number 3 Region: 41-117
Classification Level Classification E-value
Superfamily PGBD-like 2.04e-16
Family MMP N-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033278   Gene: ENSMUSG00000030981   Transcript: ENSMUST00000033278
Sequence length 568
Comment pep:known chromosome:GRCm38:7:133674270:133680061:-1 gene:ENSMUSG00000030981 transcript:ENSMUST00000033278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAASVLRLTLPLCWLVAPQPTQPERLFHSRDRSDLEPSPLSQAKPIADLHDAQSFLLKY
GWSEIPSPKESAGVPVGFTLAQAVRRFQKANRLPASGELDSPTLAAMNKPRCGVPDTRLP
PRAALPTPPALLTSLGLRPRARQKRFLQMLFPKPDGQQEDASDTGASRAFSKKTLTWRLV
GDAYSSQLSGDEQRYIFRLAFRMWSEVTPLDFREDRTAPGTMVDIKLGFGRGRHLGCPRV
FDGSGQEFAHAWRLGEIHFDDDEHFTPLSSDTGISLLKVAVHEIGHVLGLPHTYRVGSIM
QPNYIPQEPAFELDWADRKAIQRLYGSCKGSFDTVFDWIRKERNQYGEVRVRFNTYFFRN
SWYWLYENRNNRTRYGDPLQILTGWRGIPTQSIDAYVHVWSWGKDERYFFKGSQYWRYDS
ENDQAHTEDEQGRSYPKLISEGFPGIPSPLDTAFYDRRQQLIYFFKESLVFAFDVNRNQV
LNSYPKKMSQVFPAIMPQNHPFRNLDSAYYSYAHNSIFFFKGNSYWKVVSDKDKQQNTRL
PLNGLFPKKPVSEKWFDVCDVHTSTLNM
Download sequence
Identical sequences Q3KP73 Q8K3F2
ENSMUSP00000033278 NP_694423.1.92730 10090.ENSMUSP00000033278 ENSMUSP00000033278 ENSMUSP00000033278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]