SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034441 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034441
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.7e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000372
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 4.45e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000155
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.92e-39
Family AlaX-like 0.032
Further Details:      
 
Domain Number 4 Region: 515-593
Classification Level Classification E-value
Superfamily Translation proteins 6.52e-16
Family AlaX-M N-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034441   Gene: ENSMUSG00000031960   Transcript: ENSMUST00000034441
Sequence length 968
Comment pep:known chromosome:GRCm38:8:111033902:111057664:1 gene:ENSMUSG00000031960 transcript:ENSMUST00000034441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDATLTAREIRERFINFFRRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECRQIWQNLGLDEARILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRESDGVLKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFMPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPEMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMNGFEEERRLAQLKSQGKGAGDEDLIMLDIYAIEELRAKGLEA
TDDSPKYNYQSDSSGSYVFECTVATVLALRREKMFVDEVVTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGNLKVGDQVRLFIDEPRRRP
VMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIVNGMI
EAAKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPCGPAGSLTSV
EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKSETLKKSLSAMEAK
VKAQTAPNKDVQREIADLGEALATAVIPQWQKDEQRETLKSLKKVMDDLDRASKADVQKR
VLEKTKQLIDSNPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDMSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN
Download sequence
Identical sequences Q8BGQ7
10090.ENSMUSP00000034441 NP_666329.2.92730 XP_006530984.1.92730 XP_006530985.1.92730 XP_006530987.1.92730 XP_017168237.1.92730 ENSMUSP00000034441 ENSMUSP00000034441 ENSMUSP00000122388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]