SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034487 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034487
Domain Number 1 Region: 289-482
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.16e-60
Family Hemopexin-like domain 0.00000552
Further Details:      
 
Domain Number 2 Region: 108-272
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.16e-58
Family Matrix metalloproteases, catalytic domain 0.00000451
Further Details:      
 
Domain Number 3 Region: 31-104
Classification Level Classification E-value
Superfamily PGBD-like 1e-16
Family MMP N-terminal domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034487   Gene: ENSMUSG00000018620   Transcript: ENSMUST00000034487
Sequence length 482
Comment pep:known chromosome:GRCm38:9:7628231:7674968:1 gene:ENSMUSG00000018620 transcript:ENSMUST00000034487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLPASGLAVLVTALKFATADPNLLAATPRTFRSNYHLAQAYLDKYYTKKGGPQAGEMV
ARESNPMIRRIKELQIFFGLKVTGKLDQNTMNVIKKPRCGVPDVANYRLFPGEPKWKKNI
LTYRISKYTPSMSPTEVDKAIQMALHAWSTAVPLNFVRINSGEADIMISFETGDHGDSYP
FDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLGHSTDPS
ALMYPTYKYQNPYRFHLPKDDVKGIQALYGPRKIFPGKPTMPHIPPHKPSIPDLCDSSSS
FDAVTMLGKELLFFKDRIFWRRQVHLPTGIRPSTITSSFPQLMSNVDAAYEVAERGIAFF
FKGPHYWVTRGFHMQGPPRTIYDFGFPRHVQRIDAAVYLKEPQKTLFFVGEEYYSYDERK
KKMEKDYPKNTEEEFSGVSGHIDAAVELNGYIYFFSGRKTFKYDTEKEDVVSVVKSSSWI
GC
Download sequence
Identical sequences P57748
ENSMUSP00000034487 NP_038931.1.92730 ENSMUSP00000034487 ENSMUSP00000034487 10090.ENSMUSP00000034487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]