SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034497 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034497
Domain Number 1 Region: 287-479
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.02e-69
Family Hemopexin-like domain 0.000000533
Further Details:      
 
Domain Number 2 Region: 104-268
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.02e-57
Family Matrix metalloproteases, catalytic domain 0.000000134
Further Details:      
 
Domain Number 3 Region: 35-99
Classification Level Classification E-value
Superfamily PGBD-like 5.34e-20
Family MMP N-terminal domain 0.0000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034497   Gene: ENSMUSG00000043613   Transcript: ENSMUST00000034497
Sequence length 479
Comment pep:known chromosome:GRCm38:9:7445822:7455972:1 gene:ENSMUSG00000043613 transcript:ENSMUST00000034497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMKGLPVLLWLCVVVCSSYPLHDSARDDDAGMELLQKYLENYYGLAKDVKQFIKKKDSS
LIVKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFPGSPKWRKSHITYRI
VNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFVPFDGPG
TVLAHAYAPGPGINGDAHFDDDERWTEDVTGTNLFLVAAHELGHSLGLYHSAKAEALMYP
VYKSSTDLSRFHLSQDDVDGIQSLYGTPTASPDVLVVPTKSNSLEPETSPMCSSTLFFDA
VSTLRGEVLFFKDRHFWRKSLRTPEPEFYLISSFWPSLPSNMDAAYEVTNRDTVFIFKGN
QFWAIRGHEELAGYPKSIHTLGLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQSM
EPGFPRKIAEDFPGVDSRVDAVFEAFGFLYFFSGSSQLEFDPNAKKVTHILKSNSWFNC
Download sequence
Identical sequences Q922W6
NP_034939.1.92730 ENSMUSP00000034497 ENSMUSP00000034497 ENSMUSP00000034497 10090.ENSMUSP00000034497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]