SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034912 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034912
Domain Number 1 Region: 621-689,923-1259
Classification Level Classification E-value
Superfamily Ras GEF 2.48e-118
Family Ras GEF 0.0000093
Further Details:      
 
Domain Number 2 Region: 226-448
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 24-155
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-20
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 436-590
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000184
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034912   Gene: ENSMUSG00000032356   Transcript: ENSMUST00000034912
Sequence length 1262
Comment pep:known chromosome:GRCm38:9:89909909:90026977:1 gene:ENSMUSG00000032356 transcript:ENSMUST00000034912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKAIRLNDGHVVTLGLLAQKDGTRKGYLSKRSADNPKWQTKWFALLQNLLFYFESDSSP
RPSGLYLLEGSICKRAPSPKRGTSSKESGEKQQHYFTVNFSNDSQKTLELRTEDAKDCDE
WVAAIARASYKILATEHEALMQKYLHLLQVVETEKTVAKQLRQQLEDGEVEIERLKTEVT
ITNLIKDNDRIQSSNKAGSADDEDSDIKKIKKVQSFLRGWLCRRKWKNIIQDYIRSPHAD
SMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETI
MFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDF
DKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKL
EELSRIMHDEVSETENIRKNLAIERMITEGCEILLDTSQTFVRQGSLMQMSLSEKSKSSR
GRLGSLSTKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLDEPENLDDEA
KGAGPEIEHLEFKIGVEPKDSLPFTVILVASTRQEKAAWTSDIIQCVDNIRCNGLMMNAF
EENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSID
FLNTFLHSYRVFTNAMVVLDKLINIYRKPMSAIPARSLELLFSSSHNAKLLYGDAPKSPR
ASRKFSSPPPLAIGTSSPSRRRKLSLNIPIITGGKALELASLGCSSDSYANIHSPISPFG
KTTLDTGKLCMASSLPKTPEEIDVPATIPEKPGELSASRKHSSDVLKEESEDDQNHSDED
NTEVSPVKSPPTPKSFLNRTITEFPFFNYNNGILMTTCRDLVDNNRSTLSATSAFAIATA
GANEGPSNKEVFRRMSLANTGFSSDQRNIDKEFVIRRAATNRVLNVLRHWVTKHTQDFDT
DDTLKYRVICFLEEVMHDPDLLTQERKAAANIIRTLTLEETTEQHSMLEEVILMTEGVKT
EPFENHPALEIAEQLTLLDHLVFKSIPYEEFFGQGWMKAEKYERTPYIMKTTKHFNHVSN
FIASEIIRNEDISARASAIEKWVAVADICRCLHNYNAVLEITSSINRSAIFRLKKTWLKV
SKQTKSLLDKLQKLVSSDGRFKNLRESLRNCDPPCVPYLGMYLTDLVFIEEGTPNYTEDG
LVNFSKMRMISHIIREIRQFQQTTYKIDPQPKVIQYLLDESFMLDEESLYESSLLIEPKL
PT
Download sequence
Identical sequences B2RS27 P27671
ENSMUSP00000034909 ENSMUSP00000034912 10090.ENSMUSP00000034912 NP_035375.1.92730 ENSMUSP00000034912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]