SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035220 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035220
Domain Number 1 Region: 246-379
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-56
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 113-242
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.61e-51
Family cAMP-binding domain 0.0000494
Further Details:      
 
Domain Number 3 Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.17e-21
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035220   Gene: ENSMUSG00000032601   Transcript: ENSMUST00000035220
Sequence length 402
Comment pep:known chromosome:GRCm38:9:108692143:108749512:1 gene:ENSMUSG00000032601 transcript:ENSMUST00000035220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHIQIPAGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHT
QESSAVPVIEEDGESDSDSEDADLEVPVPSKFTRRVSVCAETFNPDEEEEDNDPRVVHPK
TDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERG
TYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIIATSEGSLWGLDRVTFRRIIV
KNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQGEKADSFYIIE
SGEVSILIRSKTKSNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVM
DVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSNLDLMDPGQ
Download sequence
Identical sequences Q8K1M3
10090.ENSMUSP00000035220 ENSMUSP00000035220 NP_032950.1.92730 3j4q_B 3j4q_C 3j4r_B 3j4r_C ENSMUSP00000035220 ENSMUSP00000035220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]