SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036180 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036180
Domain Number 1 Region: 149-517
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.36e-95
Family Phosphonoacetate hydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 594-860
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.47e-36
Family DNA/RNA non-specific endonuclease 0.0085
Further Details:      
 
Domain Number 3 Region: 56-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000262
Family Somatomedin B domain 0.0017
Further Details:      
 
Domain Number 4 Region: 104-144
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000262
Family Somatomedin B domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036180   Gene: ENSMUSG00000022425   Transcript: ENSMUST00000041591
Sequence length 862
Comment pep:known chromosome:GRCm38:15:54838901:54920002:-1 gene:ENSMUSG00000022425 transcript:ENSMUST00000041591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQGCFGSYQVISLFTFAIGVNLCLGFTASRIKRAEWDEGPPTVLSDSPWTNTSGSCKG
RCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCS
EDCLSRGDCCTNYQVVCKGESHWVDDDCEEIRVPECPAGFVRPPLIIFSVDGFRASYMKK
GSKVMPNIEKLRSCGTHAPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDAT
FHLRGREKFNHRWWGGQPLWITATKQGVRAGTFFWSVSIPHERRILTILQWLSLPDNERP
SVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKTVGQLMDGLKQLKLHRCVNVIFVGDHG
MEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRPKIPNNLKYDPKAIIANLTCKKPDQHF
KPYMKQHLPKRLHYANNRRIEDLHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKV
NSMQTVFVGYGPTFKYRTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTFR
PTLPEEVSRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLEELNKRLHTKGSTEERHLLYGR
PAVLYRTSYDILYHTDFESGYSEIFLMPLWTSYTISKQAEVSSIPEHLTNCVRPDVRVSP
GFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWTYFQRVLV
KKYASERNGVNVISGPIFDYNYNGLRDIEDEIKQYVEGSSIPVPTHYYSIITSCLDFTQP
ADKCDGPLSVSSFILPHRPDNDESCNSSEDESKWVEELMKMHTARVRDIEHLTGLDFYRK
TSRSYSEILTLKTYLHTYESEI
Download sequence
Identical sequences Q9R1E6
ENSMUSP00000036180 NP_056559.2.92730 10090.ENSMUSP00000036180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]