SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036997 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036997
Domain Number 1 Region: 70-185
Classification Level Classification E-value
Superfamily Ras GEF 7.72e-18
Family Ras GEF 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036997   Gene: ENSMUSG00000041505   Transcript: ENSMUST00000036715
Sequence length 326
Comment pep:known chromosome:GRCm38:5:146514151:146516724:1 gene:ENSMUSG00000041505 transcript:ENSMUST00000036715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCFQGSRGSGHKKAKSGFLVRFWRRLIRPLTHFRHASHSEPKVCSQNEQEPDSLPKRP
QFNYDSQEYVVQMIHYFPAAIQKRDHICITIFLGVYRTYASTWEVLDLLMRTYASFRPDC
IKDQQTKRAIFRFLFGWFKKYPQDFYESPDLAVVRQFIDYVKHNVPSSDVDRARELLSVL
EDQEAIELQIEQACLLLLLNFATAPEPSEQDASGRQETLAPRPASETEPQGDKQPREDPE
LVKGAVLDPSEPKATIELPPSLHQAVPTSDGTLSPVDVTADEATGVAADEAADVAADVSP
ARQLFVSYTVQLGTPDFVIPLPEVDI
Download sequence
Identical sequences K7N5P2
ENSMUSP00000076380 ENSMUSP00000036997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]