SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038914 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038914
Domain Number 1 Region: 10-180,282-388
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.27e-48
Family FAD-linked reductases, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038914   Gene: ENSMUSG00000039783   Transcript: ENSMUST00000040250
Sequence length 479
Comment pep:known chromosome:GRCm38:1:175631996:175660853:1 gene:ENSMUSG00000039783 transcript:ENSMUST00000040250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSDTQGKRVAVIGGGLVGALNACFLAKRNFQVDVYEAREDIRVAKSARGRSINLALSY
RGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLT
AVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPRDVTCDLVVGCDGAYSTVRAHLMKK
PRFDYTQQYIPHGYMELTIPPKNGEYAMEPNCLHIWPRNAYMMIALPNMDKSFTCTLFMP
FEEFERLPTRSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSHCV
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLS
MYNYIEMRAHVNSRWFLFQKLLDKFLHAIMPSTFIPLYTMVAFTRIRYHEAVLRWHWQKK
VINRGLFVLGSLIAIGGTYLLVHHLSLRPLEFLRRPAWMGTTGYWTRSTDISLQVPWSY
Download sequence
Identical sequences Q91WN4
ENSMUSP00000095067 ENSMUSP00000038914 ENSMUSP00000038914 10090.ENSMUSP00000038914 NP_598570.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]