SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000039915 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000039915
Domain Number 1 Region: 288-448
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000309
Further Details:      
 
Domain Number 2 Region: 75-184
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-30
Family Spermadhesin, CUB domain 0.00081
Further Details:      
 
Domain Number 3 Region: 188-285
Classification Level Classification E-value
Superfamily LCCL domain 2.88e-23
Family LCCL domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000039915   Gene: ENSMUSG00000035107   Transcript: ENSMUST00000046663
Sequence length 769
Comment pep:known chromosome:GRCm38:16:58408443:58469727:1 gene:ENSMUSG00000035107 transcript:ENSMUST00000046663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRAPLRAARSPQGPGGPAAPAATGRAALPSAGCCPLPPGRNSSSRPRLLLLLLLLLQD
AGGQQGDGCGHTVLGPESGTLTSINYPHTYPNSTVCEWEIRVRTGERIRIKFGDFDIEDS
DYCHLNYLKIFNGIGVSRTEIGKYCGLGLQMNQSIESKGSEVTVLFMSGTHAAGRGFLAS
YSVIDKEDLITCLDTVSNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGIHA
GVVSNVLGGQISIVISKGTPYYESSLANNVTSTVGYLSASLFTFKTSGCYGTLGMESGVI
ADPQITASSALEWTDHMGQENSWTAEKARLRKPGPPWAAFATDEHQWLQIDLNKEKKITG
IVTTGSTMIEHSYYVSAYRVLYSDDGQRWTVYREPGVDQDKIFQGNKDYHKDVRNNFLPP
IIARFIRVNPVQWQQKIAMKVELLGCQFTLKGRLPKLTPPPRNGNNLRNTTARPKLGKGR
APKFTQVLQPRSRNELPVQPAETTTTPDIKNTTVTPSVTKDVALAAVLVPVLVMALTTLI
LILVCAWHWRNRKKKTEGAYDLPHWDRAGWWKGMKQLLPAKSVDHEETPVRYSTSEVSHL
SAREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPMQEVYHA
YAEPLPVTGPEYATPIVMDMSGHPTASVGLPSTSTFKTAGTQPHALVGTYNTLLSRTDSC
SSGQAQYDTPKGGKSAATPEELVYQVPQSTQELSGAGRDEKFDAFKEIL
Download sequence
Identical sequences Q91ZV3
ENSMUSP00000039915 NP_082799.2.92730 10090.ENSMUSP00000039915 ENSMUSP00000039915 ENSMUSP00000039915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]