SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000040163 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000040163
Domain Number 1 Region: 337-367,406-484
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.69e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000040163   Gene: ENSMUSG00000034320   Transcript: ENSMUST00000037603
Sequence length 504
Comment pep:putative chromosome:GRCm38:18:61197222:61200369:-1 gene:ENSMUSG00000034320 transcript:ENSMUST00000037603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSHGVGSVITTWIHIFR
NIRNTNICDLITSLLCLLVLVPSKELNEHFKDKLKAPIPVELIVVVAATLASHFGKLNGN
YNSSIAGHIPTGFMPPKAPDWSLIPNVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKAN
QEMYAIGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAIVTALVLLLVLLVIAPLF
YSLQKCVLGVITIVNLRGALLKFRDLPKMWRLSRMDTVIWFVTMLSSALLSTEIGLLVGV
CFSMFCVILRTQKPKNSLLGLEEESETFESISTYKNLRSKSGIKVFRFIAPLYYINKECF
KSALYKKALNPVLVKAAWKKAAKRKLKEEMVTFRGDPDEVSMQLSHDPLEVHTIVIDCSA
IQFLDTAGIHTLKEVRRDYEAVGIQVLLAQCNPSVRDSLARGEYCKKEEETLLFYSLSEA
VAFAEDSQNQKGVCVVNGLSLSGD
Download sequence
Identical sequences F8WI08
ENSMUSP00000040163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]