SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041104 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041104
Domain Number 1 Region: 477-607
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.1e-54
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000195
Further Details:      
 
Domain Number 2 Region: 126-345
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000312
Further Details:      
 
Domain Number 3 Region: 298-474
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.02e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000697
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041104   Gene: ENSMUSG00000036932   Transcript: ENSMUST00000037349
Sequence length 612
Comment pep:known chromosome:GRCm38:X:48474944:48513563:-1 gene:ENSMUSG00000036932 transcript:ENSMUST00000037349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPGNLFQQWRVPLELQMARQMASSGSSG
GKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGLGLSPEEKQRRAIASATEGG
SVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWF
SDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGN
MVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVK
SITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGV
KVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGF
RVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSM
FWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEI
TIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDL
NEVAKLFNIHED
Download sequence
Identical sequences Q9Z0X1
ENSMUSP00000041104 10090.ENSMUSP00000041104 ENSMUSP00000041104 ENSMUSP00000041104 NP_036149.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]