SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041789 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041789
Domain Number 1 Region: 497-527,566-633
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000051
Family Anti-sigma factor antagonist SpoIIaa 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041789   Gene: ENSMUSG00000040569   Transcript: ENSMUST00000042221
Sequence length 656
Comment pep:known chromosome:GRCm38:4:14502430:14621805:-1 gene:ENSMUSG00000040569 transcript:ENSMUST00000042221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKRKKRSVLWGKMHTPHREDIKQWCKRRLPILEWAPQYNLKENLLPDTVSGIMLAVQ
QVAQGLSFAMLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERLVP
QSSRNLTTQSNSSVLGLSEFELQRIGVAAAVSFLGGVIQLVMFVLQLGSATFLLTEPVIS
AMTTGAATHVVTSQVKYLLGIKMPYISGPLGFFYIYAYVFENIKSVQLEALLFSLLSIIV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPNGIPPPRAP
PMNILSAVLTEAFGVALVGYVASLALAQGSAKKFKYSVDDNQEFLAHGLSNVIPSFLFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWISTYIFTICFAANVGLLFGVICTIAIVLGRFPRAKTLSI
TDMKEMELKVKTEMHDETSQQIKIISINNPLVFLNAKKFSADLMKIILKESDSNQPLDDV
SKCEQNTLLSSLSNGNCNEEASQPCSSEKCSLVLNCSGLTFFDYTGVSTLVELYLDCKSR
SVDVFLANCTASLIKAMTYYGDLDTEKPIFFDSVPAAISIIQSNKNLSKASDHSEV
Download sequence
Identical sequences Q8R2Z3
ENSMUSP00000041789 ENSMUSP00000041789 ENSMUSP00000041789 10090.ENSMUSP00000041789 NP_666059.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]