SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000043311 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000043311
Domain Number 1 Region: 106-272
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0059
Further Details:      
 
Domain Number 2 Region: 252-367
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.33e-22
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 489-552
Classification Level Classification E-value
Superfamily SH3-domain 9.19e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 4 Region: 573-605,639-727
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000000458
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000043311   Gene: ENSMUSG00000042303   Transcript: ENSMUST00000042506
Sequence length 760
Comment pep:known chromosome:GRCm38:15:80977765:81012289:1 gene:ENSMUSG00000042303 transcript:ENSMUST00000042506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSCRRPQHMMSGNHTPSASGPFSALTPSIWPQEILAKYSQKEESSEQPELCYDEFGFRV
DKEGSEPGCSQMTGSPLVEDPPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSL
VLAGIPHGMRPQLWMRLSGALQKKKNSELSYREIIKNSSNDETIAAKQIEKDLLRTMPSN
ACFANVNSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAIIED
LLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVH
IRLLLRIWDLFFYEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPAQMDDAELL
LGEAMRLAGSLTDVAVETQRRKHLAYLIADQGQTLGTGTTTNLSQVVRRRTQRRKSGITS
LLFGEDDLEALKAKNIKQTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRD
HENYVACLRSHRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFP
AKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWL
FIEEAAGREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQM
DVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFA
FSLSQDWELPARREEEKQPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences ENSMUSP00000043311 XP_006520310.1.92730 XP_006520311.1.92730 ENSMUSP00000043311 ENSMUSP00000122543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]