SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000044078 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000044078
Domain Number 1 Region: 944-1230
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.31e-58
Family Patatin 0.041
Further Details:      
 
Domain Number 2 Region: 164-302
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.33e-23
Family cAMP-binding domain 0.019
Further Details:      
 
Domain Number 3 Region: 606-722
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-22
Family cAMP-binding domain 0.0067
Further Details:      
 
Domain Number 4 Region: 496-610
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-18
Family cAMP-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000044078   Gene: ENSMUSG00000036833   Transcript: ENSMUST00000045295
Sequence length 1352
Comment pep:known chromosome:GRCm38:2:24976033:25054057:1 gene:ENSMUSG00000036833 transcript:ENSMUST00000045295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNEEDACLEAGYCLGTTLSSWRLHFMEEQSQSTMLMGIGIGALLTLAFVGITFFFVYRR
VRRLRRAEPTPQYRFRKRDKVMFYGRKIMRKVTTLPHTLVGNTSAPRQRVRKRTKVLSLA
KRILRFKKEYPTLQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHMVFVQLQEGEHVFQPGEPDISIYVVQDGRLEVCIQDADGTEVVVKEVLPGDSVHS
LLSILDVITGHTAPYKTVSARAAVSSTVLWLPAAAFQGVFEKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNPESQAIPLLSVASVAGRAKRQMSYGPEEQLERSLRPSEFSSS
DHGSSCVTVSGPLLKRSCSVPLPSNHGEVDELRQSQGSGSNTSAFQESHEGATSDLGMAY
NRARILPHSDEQLGNSLASKSKKSVVAETPSAIFHYSENFRDETGACGKTDAIFRAATKD
LLTLMKLDDPSLLDGRVAFLHVPAGTLVSKQGDQDVNILFVVSGMLHVYQQKIDSLEDTC
LFLTHPGEMVGQLAVLTGEPLMFTIRANRDCSFLSISKAHFYEIMRKRPDVVLGVAHTVV
KRMSSFVRQIDFALDWMEVEAGRAIYRQGDKSDCTYIVLSGRLRSVIRKDDGKKRLAGEY
GRGDLVGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGEKIL
GSLQQGSATGHQLGFNTASSKWDLGNPPGNLSTVAALPASEDVPLTAFALELQHALSAIG
PVLLLTSDNIKQRLGSAALDSIHEYRLSSWLGQQEDIHRIVLYQADGTLTPWTQRCIRQA
DCILIVGLGEQEPAVGELEQMLESTAVRAQKQLILLHKEDGPVPSRTVEWLNMRSWCSGH
LHLCCPRRVFSKRSLPKLVEMYTRVFQRPPDRHSDFSRLARMLTGNAIALVLGGGGARGC
AQVGILRALAECGVPVDIIGGTSIGAFMGALFAEERSYSQTRIRAKQWAEGMTSMMKTIL
DLTYPITSMFSGTGFNSSISNIFKDRQIEDLWLPYFAITTDITASAMRVHTDGSLWRYVR
ASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSRDETDLTNYG
DALSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEMVKNSDYCEYLRPPIDSY
RTLDFGKFDEICEVGYQHGRTVFDIWVRSGVLEKMLQDQQGTSKRKDCGVFTCPNSSFTD
LAEIVSRIEPAKVAAVDDESDYQTEYEEELPAIPKETYADFQSTGIELDSDSEYEPSMLQ
GPPSLTSPEQSQDSFPWLPNQDDQGPRLEHPS
Download sequence
Identical sequences A2AJ88
ENSMUSP00000044078 10090.ENSMUSP00000044078 ENSMUSP00000044078 NP_666363.3.92730 ENSMUSP00000044078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]