SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000045196 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000045196
Domain Number 1 Region: 135-226
Classification Level Classification E-value
Superfamily SEA domain 0.0000017
Family SEA domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000045196
Domain Number - Region: 56-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00412
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 95-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000045196   Gene: ENSMUSG00000037390   Transcript: ENSMUST00000041226
Sequence length 442
Comment pep:known chromosome:GRCm38:5:137134950:137149320:-1 gene:ENSMUSG00000037390 transcript:ENSMUST00000041226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADVTTTADVTTTIDVTTTADVTTSAEVTTTADVTTTTEVTTTTEVATTPEPTTTPAPTTT
AVNCMNGGFWTGDKCICPNGFGGDRCENIVNVVNCENGGTWDGLKCQCTSLFYGPRCEEL
VESVEIEPTVAASVEVSVTVTSQEYSEKLQDRKSEEFSNFNKTFTKQMALIYAGIPEYEG
VIIKNLSKGSIVVDYDVILKAKYTPGFENTLDTVVKNLETKIKNATEVQVQDVNNNCSAL
LCFNSTATKVQNSATVSVNPEETCKKEAGEDFAKFVTLGQKGDKWFCITPCSAGYSTSKN
CSYGKCQLQRSGPQCLCLITDTHWYSGENCDWGIQKSLVYGLGGAGVAVLLVILVILLVF
SIRFRKDAQRQRSRVSEMYKWGEEEGRASPGTFHNFGFDHNEERENYMPLDSVYNTFQPS
LNHINPERKIQIQRPQVVMTSL
Download sequence
Identical sequences ENSMUSP00000045196 ENSMUSP00000123755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]