SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046476 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046476
Domain Number 1 Region: 18-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.73e-58
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 235-277
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000471
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046476   Gene: ENSMUSG00000033781   Transcript: ENSMUST00000042288
Sequence length 278
Comment pep:known chromosome:GRCm38:13:3634032:3651774:1 gene:ENSMUSG00000033781 transcript:ENSMUST00000042288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRAGDGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIDSGACVNQVTVDSITPLHAAS
LQGQAQCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASP
LHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAK
LHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPL
SLSQLCRVSLRKATGVRGLEKVAKLNIPPRLIDYLSYN
Download sequence
Identical sequences Q8VBX0
ENSMUSP00000046476 ENSMUSP00000046476 ENSMUSP00000046476 10090.ENSMUSP00000046476 NP_840068.1.92730 XP_021071503.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]