SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046544 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046544
Domain Number 1 Region: 538-601,867-986
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 
Domain Number 2 Region: 8-199
Classification Level Classification E-value
Superfamily RUN domain-like 5.62e-35
Family RUN domain 0.00062
Further Details:      
 
Domain Number 3 Region: 963-1085
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.11e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046544   Gene: ENSMUSG00000042216   Transcript: ENSMUST00000048112
Sequence length 1093
Comment pep:known chromosome:GRCm38:5:113243220:113310786:-1 gene:ENSMUSG00000042216 transcript:ENSMUST00000048112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVPAEAETRQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRR
AAGFLRSNKIAALFMKVGKGFPPAEELSRKVQELEQLIESARNQIQGLQENVRKLPKLPN
LSPLAIKHLWIRTALFERVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCAL
EYTKMKTADHFWTDPSADELVQRHRIHSSHLRQDSPTKRPALCIQKRHSSGSMDDRPSIS
ARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGS
VGDLDYEKSVYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLL
QFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSSESTSSDKEDDEATDYVFR
IIYPGTQSEFVPQDLMDVSMNNLPPLWQPSPRKSSCSSCSQSGSADGGSTNGCNHERAPL
KLLCDNMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAGQGLTASIWE
KYIQDSTTYPEQELLRLIYYGGVQPEIRRAVWPFLLGHYQFGMTEMERKEVDEQIHACYA
QTMSEWLGCEAIVRQRERESHAAALAKCSSGASLDSHLHRMLHRDSTISNESSQSCSSGR
QNLRLQSDSSSSTQVFESVDEVEQTEAEGRSEEKHPKIPNGNPANGTCSPDSGHPSSHNF
SSGLSEHSEPSLSTEDSVLDAQRSLPAVFRPGDSSVEDGQSSEATTSRDEAPREELAVQD
SLESDLLANESLEEFMSIPGSLDVALPEKDGAVMDGWPGEADKPSRADSEDNLSEEPEME
SLFPALASLAVTSSANNEASPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRSYWYFTA
ANLEKLRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDDEALAFSCFTELMKRMNQNFPH
GGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWE
TIWAAKHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNAKQILQLAR
DLVHKVQILIENK
Download sequence
Identical sequences B2RQR5
NP_766306.2.92730 ENSMUSP00000046544 ENSMUSP00000046544 ENSMUSP00000046544 10090.ENSMUSP00000046544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]