SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046692 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000046692
Domain Number - Region: 29-126
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.1
Family Gonadodropin/Follitropin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046692   Gene: ENSMUSG00000040138   Transcript: ENSMUST00000040134
Sequence length 131
Comment pep:known chromosome:GRCm38:X:16885521:16911774:-1 gene:ENSMUSG00000040138 transcript:ENSMUST00000040134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNHVLAASISMLSLLAIMGDTDSKTDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVLL
ARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRY
ILSCHCEECSS
Download sequence
Identical sequences A0A061HWM4 A0A1U7R406 D3ZEP2 P48744
ENSRNOP00000003984 ENSMUSP00000046692 10090.ENSMUSP00000046692 10116.ENSRNOP00000003984 ENSRNOP00000003984 ENSRNOP00000064536 ENSMUSP00000046692 NP_001102284.1.100692 NP_001102284.1.4139 NP_035013.1.92730 XP_003510345.1.69978 XP_003752046.1.100692 XP_005080600.1.91757 XP_007626887.1.28591 XP_007626889.1.28591 XP_007626890.1.28591 XP_007649126.1.69978 XP_007649127.1.69978 XP_012976307.1.91757 XP_016826012.1.28591 XP_016826013.1.28591 XP_016826014.1.28591 XP_016835098.1.69978 XP_016835099.1.69978 XP_016835100.1.69978 XP_017457590.1.100692 XP_021044135.1.100879 XP_021483981.1.76796 XP_021483983.1.76796 ENSMUSP00000046692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]