SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000047261 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000047261
Domain Number 1 Region: 271-463
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.35e-60
Family Hemopexin-like domain 0.000000356
Further Details:      
 
Domain Number 2 Region: 98-262
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.04e-51
Family Matrix metalloproteases, catalytic domain 0.0000062
Further Details:      
 
Domain Number 3 Region: 26-94
Classification Level Classification E-value
Superfamily PGBD-like 1.22e-18
Family MMP N-terminal domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000047261   Gene: ENSMUSG00000041620   Transcript: ENSMUST00000047888
Sequence length 463
Comment pep:known chromosome:GRCm38:9:7368239:7388047:-1 gene:ENSMUSG00000041620 transcript:ENSMUST00000047888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLPLLLLLWAASSYSFPVIQDGLQKNVKTVWKYLENYYNLGKNMQAKNVNGKEVMAEK
LRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAPYAITHNNPRWTKTHLTYSILNYTP
YLSKAVVEDAIARAFRVWSDVTPLTFQRVFEEEGDIVLSFHRGDHGDLYTFDGSKYHFAH
AFLPGLGLGGNVHYDLDQKWTDNNEDFNLFYVTAHELGHSLGLSHSNDEEALMFPSYTWS
NKDFVLNQDDINRIQALYGPSPNPIQLTDATLDPCNSGLTFDAIITYRGEVIFFKDRFYI
RVISFLPEPLIDVIDLIWPNLPGKFDAAYEVSGVDELRFFKGSKVWAVQEQNVLEGFPMD
IQSFFGFPSNVTNIDAAVCEEETGKTYFFVDHMYWRYDENTRSMDPGYPRLIAEDFPGID
YKVDDVIQKEDNFYFFHQSIQYRFNLKTRRIDDSSDINTWFNC
Download sequence
Identical sequences G5E8A9
ENSMUSP00000047261 ENSMUSP00000047261 ENSMUSP00000047261 NP_114396.3.92730 10090.ENSMUSP00000047261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]