SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000047327 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000047327
Domain Number 1 Region: 15-186
Classification Level Classification E-value
Superfamily RUN domain-like 1.83e-40
Family RUN domain 0.00088
Further Details:      
 
Domain Number 2 Region: 545-657
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-16
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 701-802
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000971
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000047327
Domain Number - Region: 1016-1069
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0633
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000047327   Gene: ENSMUSG00000034247   Transcript: ENSMUST00000041272
Sequence length 1074
Comment pep:known chromosome:GRCm38:11:103364275:103412687:-1 gene:ENSMUSG00000034247 transcript:ENSMUST00000041272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVENGLDPRAAIQVIKKKLVGSVKALQKQHVSLDTVVTSEDGDANTMCSALEAVFIHG
LHAKHIRAEAGGKRKKHTHQKALPQPVFWPLLKAITHRHIVSDLEHLVFINTDVGRCRAW
LRLALNDGLMECYLKLLLQEPARLCEYYQPTALLRDAEEAEFLLSFLQGLTSLSFELSYK
SAILNEWTLTPLSLSGLCPLSELDPLTTSGAELQRKESLDSISHSSGSEDIEVQHSGHKI
RRNRKLTASSLSLDTASSSQLSCSLNSDSCLLQENGPKSPDHSEEPMSYDSDLGMANTDD
PDRSLQEVLSEFSKAQVNSAPSSGPNQEPDTPMFQTPLSLHSLATSTHLHFEGSEELFPA
HKSSGTSSGGHKHQLLPQETPDEKQLGTAQAGPAQSTSDQQPSSPVGGAAGQGSGPWKAL
EYGRVGPKLVVSSPTSPKGKSWISEDDFCRPPQEPALKSAAGLCTSPVQDTPESRAALHG
PFSQGPRKSCSLGALDKACVPSQACGNAQPAPAPAPAPAPAPAPAPGVTQDHKNFCVVHR
RQMGLSNPFRGLMKLGTVARRGAMGIWKEFFCELSPLEFRLYLSDEERTCVESCSLLRCE
AVGPAHSDGRFELVFSGKKLALRASSQDEAEDWLDRVREALQKVRPQQEDEWVNIQYPDQ
AEDAPEAPPDSLPPYSTLLPEPAGAQGMQLDWTSAQVPEPDAIKESLLYLYADRTWVPYI
FSLSLESLKCFRVRNNEKMLSDSHGVETIRDILPDTSLGGPAFFKIITAKAVLKLQAKNT
EEATHWRDLVRKVLASYLESAEEAVTLGGSLDEKCQEVLKFATRENGFLLQYLVAIPTEK
GLDSQGCFCAGCSRQIGFSFVRPKLCAFSGLYYCDFCHQDDASVIPARIIHNWDLTKRPV
CRQALKFLAQIRAQPLINLQLVNASLYEHVERMHLIGRSREQLKLLGDYLGLCRSGALKE
LCKRLSHRNYLLESPHRFSVADLQQIAEGVYEGFLKALIEFASQHVYHCDLCTQRGFICQ
ICHHQDIIFPFEFDTTVRCAECRTVFHQSCQAVVRKGCPRCARRRKYQEQNVVS
Download sequence
Identical sequences Q7TSI1
ENSMUSP00000047327 10090.ENSMUSP00000047327 ENSMUSP00000047327 ENSMUSP00000047327 NP_898855.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]